TCP11 Antibody

Name TCP11 Antibody
Supplier Novus Biologicals
Catalog NBP1-57698
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TCP11(t-complex 11 homolog (mouse)) The peptide sequence was selected from the middle region of TCP11 (NP_061149). Peptide sequence CVCSVIDQRIHLFLKCCLVLGVQRSLLDLPGGLTLIEAELAELGQKFVNL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TCP11
Conjugate Unconjugated
Supplier Page Shop

Product images