ZPBP2 Antibody

Name ZPBP2 Antibody
Supplier Novus Biologicals
Catalog NBP1-57768
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ZPBP2 (zona pellucida binding protein 2) The peptide sequence was selected from the middle region of ZPBP2)(50ug). Peptide sequence VRLDSCRPGFGKNERLHSNCASCCVVCSPATFSPDVNVTCQTCVSVLTYG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ZPBP2
Conjugate Unconjugated
Supplier Page Shop

Product images