TINAGL1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-57765
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to TINAGL1 (tubulointerstitial nephritis antigen-like 1) The peptide sequence was selected from the middle region of TINAGL1)(50ug). Peptide sequence NLIHEPLDQGNCAGSWAFSTAAVASDRVSIHSLGHMTPVLSPQNLLSCDT.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: TINAGL1
• Conjugate: Unconjugated

Product images

Western Blot: TINAGL1 Antibody [NBP1-57765] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml

Western Blot: TINAGL1 Antibody [NBP1-57765] - ACHN cell lysate, concentration 0.2-1 ug/ml.

Western Blot: TINAGL1 Antibody [NBP1-57765] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

Western Blot: TINAGL1 Antibody [NBP1-57765] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Western Blot: TINAGL1 Antibody [NBP1-57765] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.