CHCHD1 Antibody

Name CHCHD1 Antibody
Supplier Novus Biologicals
Catalog NBP1-57761
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Bovine, Goat, Rabbit
Antigen Synthetic peptides corresponding to CHCHD1 (coiled-coil-helix-coiled-coil-helix domain containing 1) The peptide sequence was selected from the middle region of CHCHD1)(50ug). Peptide sequence KEIQGFLDCAARAQEARKMRSIQETLGESGSLLPNKLNKLLQRFPNK
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene CHCHD1
Supplier Page Shop

Product images