Name | CHCHD1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57761 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Pig, Bovine, Goat, Rabbit |
Antigen | Synthetic peptides corresponding to CHCHD1 (coiled-coil-helix-coiled-coil-helix domain containing 1) The peptide sequence was selected from the middle region of CHCHD1)(50ug). Peptide sequence KEIQGFLDCAARAQEARKMRSIQETLGESGSLLPNKLNKLLQRFPNK |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | CHCHD1 |
Supplier Page | Shop |