RIBC1 Antibody

Name RIBC1 Antibody
Supplier Novus Biologicals
Catalog NBP1-57751
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RIBC1 (RIB43A domain with coiled-coils 1) The peptide sequence was selected from the middle region of RIBC1)(50ug). Peptide sequence ANANKAQAAVQAGRQRCERQREQKANLAEIQHQSTSDLLTENPQVAQHPM.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RIBC1
Conjugate Unconjugated
Supplier Page Shop

Product images