HS1BP3 Antibody

Name HS1BP3 Antibody
Supplier Novus Biologicals
Catalog NBP1-57747
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to HS1BP3 (HCLS1 binding protein 3) The peptide sequence was selected from the N terminal of HS1BP3)(50ug). Peptide sequence YSEIEEFYQKLSSRYAAASLPPLPRKVLFVGESDIRERRAVFNEILRCVS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene HS1BP3
Conjugate Unconjugated
Supplier Page Shop

Product images