Njmu-R1 Antibody

Name Njmu-R1 Antibody
Supplier Novus Biologicals
Catalog NBP1-57746
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to Njmu-R1 The peptide sequence was selected from the middle region of Njmu-R1)(50ug). Peptide sequence KLKAIQDTNNLKRFIRQAEMNHYALFKCYMFLKNCGSGDILLKIVKVEHE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene C17orf75
Conjugate Unconjugated
Supplier Page Shop

Product images