DUS1L Antibody

Name DUS1L Antibody
Supplier Novus Biologicals
Catalog NBP1-57742
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to DUS1L (dihydrouridine synthase 1-like (S. cerevisiae)) The peptide sequence was selected from the middle region of DUS1L)(50ug). Peptide sequence KPTGDLPFHWICQPYIRPGPREGSKEKAGARSKRALEEEEGGTEVLSKNK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DUS1L
Conjugate Unconjugated
Supplier Page Shop

Product images