Deoxycytidylate deaminase Antibody
| Name | Deoxycytidylate deaminase Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57825 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to DCTD(dCMP deaminase) The peptide sequence was selected from the middle region of DCTD. Peptide sequence MSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | DCTD |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Deoxycytidylate deaminase Antibody [NBP1-57825] - ACHN cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7212_Deoxycytidylate-deaminase-Antibody-Western-Blot-NBP1-57825-img0004.jpg)
Western Blot: Deoxycytidylate deaminase Antibody [NBP1-57825] - ACHN cell lysate, concentration 0.2-1 ug/ml.