CCDC19 Antibody

Name CCDC19 Antibody
Supplier Novus Biologicals
Catalog NBP1-57843
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CCDC19(coiled-coil domain containing 19) The peptide sequence was selected from the N terminal of CCDC19. Peptide sequence MPLSTAGILSSSSAASNRSRNKARYRTKAVSSEVDESLFGDIKSPAQGQS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CFAP45
Conjugate Unconjugated
Supplier Page Shop

Product images