TNNI3K Antibody

Name TNNI3K Antibody
Supplier Novus Biologicals
Catalog NBP1-57841
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TNNI3K(TNNI3 interacting kinase) The peptide sequence was selected from the middle region of TNNI3K. Peptide sequence PGRSHVAALRSRFELEYALNARSYAALSQSAGQYSSQGLSLEEMKRSLQY.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TNNI3K
Conjugate Unconjugated
Supplier Page Shop

Product images