LYZL6 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-58032
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to LYZL6(lysozyme-like 6) The peptide sequence was selected from the N terminal of LYZL6. Peptide sequence MTKALLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCL.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: LYZL6
• Conjugate: Unconjugated