WDPCP Antibody

Name WDPCP Antibody
Supplier Novus Biologicals
Catalog NBP1-58008
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LOC51057(hypothetical protein LOC51057) The peptide sequence was selected from the N terminal of LOC51057. Peptide sequence LAQNKLCFIQFTKKMESSDVNKRLEKLSALDYKIFYYEIPGPINKTTERH.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene WDPCP
Conjugate Unconjugated
Supplier Page Shop

Product images