PRSS35 Antibody

Name PRSS35 Antibody
Supplier Novus Biologicals
Catalog NBP1-58042
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PRSS35(protease, serine, 35) The peptide sequence was selected from the N terminal of PRSS35. Peptide sequence PTQNITTKGVSVRRKRQVYGTDSRFSILDKRFLTNFPFSTAVKLSTGCSG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PRSS35
Conjugate Unconjugated
Supplier Page Shop

Product images