Chondroadherin Antibody

Name Chondroadherin Antibody
Supplier Novus Biologicals
Catalog NBP1-58039
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CHAD(chondroadherin) The peptide sequence was selected from the middle region of Chondroadherin. Peptide sequence VDRNQLSSYPSAALSKLRVVEELKLSHNPLKSIPDNAFQSFGRYLETLWL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CHAD
Conjugate Unconjugated
Supplier Page Shop

Product images