HECA Antibody

Name HECA Antibody
Supplier Novus Biologicals
Catalog NBP1-58113
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to HECA(headcase homolog (Drosophila)) The peptide sequence was selected from the middle region of HECA. Peptide sequence HKLNTFHVRMEDDAQVGQGEDLRKFILAALSASHRNVVNCALCHRALPVF.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene HECA
Conjugate Unconjugated
Supplier Page Shop

Product images