Rpn2 Antibody

Name Rpn2 Antibody
Supplier Novus Biologicals
Catalog NBP1-58214
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PSMD1(proteasome (prosome, macropain) 26S subunit, non-ATPase, 1) The peptide sequence was selected from the N terminal of PSMD1. Peptide sequence HYTKQCVENADLPEGEKKPIDQRLEGIVNKMFQRCLDDHKYKQAIGIALE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PSMD1
Conjugate Unconjugated
Supplier Page Shop

Product images