PSF2 Antibody

Name PSF2 Antibody
Supplier Novus Biologicals
Catalog NBP1-58209
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to GINS2(GINS complex subunit 2 (Psf2 homolog)) The peptide sequence was selected from the N terminal of GINS2. Peptide sequence DAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAIN.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene GINS2
Conjugate Unconjugated
Supplier Page Shop

Product images