GTSE1 Antibody

Name GTSE1 Antibody
Supplier Novus Biologicals
Catalog NBP1-58192
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to GTSE1(G-2 and S-phase expressed 1) The peptide sequence was selected from the middle region of GTSE1. Peptide sequence IDLMTNTPDMNKNVAKPSPVVGQLIDLSSPLIQLSPEADKENVDSPLLKF.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene GTSE1
Conjugate Unconjugated
Supplier Page Shop

Product images