KIF12 Antibody

Name KIF12 Antibody
Supplier Novus Biologicals
Catalog NBP1-58181
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to KIF12(kinesin family member 12) The peptide sequence was selected from the N terminal of KIF12. Peptide sequence SLGSPRPLPVRWNKTRGFYVEQLRVVEFGSLEALMELLQTGLSRRRNSAH.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene KIF12
Conjugate Unconjugated
Supplier Page Shop

Product images