KIF3A Antibody

Name KIF3A Antibody
Supplier Novus Biologicals
Catalog NBP1-58179
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to KIF3A (kinesin family member 3A) The peptide sequence was selected from the C terminal of KIF3A. Peptide sequence PVPDKKEKDPFEVDLSHVYLAYTEESLRQSLMKLERPRTSKGKARPKTGR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene KIF3A
Conjugate Unconjugated
Supplier Page Shop

Product images