KIFC3 Antibody

Name KIFC3 Antibody
Supplier Novus Biologicals
Catalog NBP1-58178
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to KIFC3(kinesin family member C3) The peptide sequence was selected from the C terminal of KIFC3 (NP_005541). Peptide sequence EHLEWEPACQTPQPSARAHSAPSSGTSSRPGSIRRKLQPSGKSRPLPV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene KIFC3
Conjugate Unconjugated
Supplier Page Shop

Product images