KIF3B Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-58138
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to KIF3B (kinesin family member 3B) The peptide sequence was selected from the C terminal of KIF3B. Peptide sequence APKVQAALDAALQDEDEIQVDASSFESTANKKSKARPKSGRKSGSSSSSS.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: KIF3B
• Conjugate: Unconjugated