MCM8 Antibody

Name MCM8 Antibody
Supplier Novus Biologicals
Catalog NBP1-58130
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MCM8 (minichromosome maintenance complex component 8) The peptide sequence was selected from the N terminal of MCM8. Peptide sequence ELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVNVPH.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene MCM8
Conjugate Unconjugated
Supplier Page Shop

Product images