Apc7 Antibody
| Name | Apc7 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-58224 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ANAPC7(anaphase promoting complex subunit 7) The peptide sequence was selected from the C terminal of ANAPC7 (NP_057322). Peptide sequence ALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDS. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ANAPC7 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Apc7 Antibody [NBP1-58224] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24771_Apc7-Antibody-Western-Blot-NBP1-58224-img0001.jpg)
Western Blot: Apc7 Antibody [NBP1-58224] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml
![Immunohistochemistry-Paraffin: Apc7 Antibody [NBP1-58224] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24772_Apc7-Antibody-Immunohistochemistry-Paraffin-NBP1-58224-img0002.jpg)
Immunohistochemistry-Paraffin: Apc7 Antibody [NBP1-58224] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.