Name | Apc7 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-58224 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB IHC IHC-P |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to ANAPC7(anaphase promoting complex subunit 7) The peptide sequence was selected from the C terminal of ANAPC7 (NP_057322). Peptide sequence ALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDS. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | ANAPC7 |
Conjugate | Unconjugated |
Supplier Page | Shop |