RALGPS1 Antibody

Name RALGPS1 Antibody
Supplier Novus Biologicals
Catalog NBP1-58314
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RALGPS1(Ral GEF with PH domain and SH3 binding motif 1) The peptide sequence was selected from the middle region of RALGPS1. Peptide sequence AGSLPTPPVPRHRKSHSLGNNMMCQLSVVESKSATFPSEKARHLLDDSVL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RALGPS1
Conjugate Unconjugated
Supplier Page Shop

Product images