RFT1 Antibody

Name RFT1 Antibody
Supplier Novus Biologicals
Catalog NBP1-58295
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RFT1(RFT1 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of RFT1. Peptide sequence GTQRDWSQTLNLLWLTVPLGVFWSLFLGWIWLQLLEVPDPNVVPHYATGV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RFT1
Conjugate Unconjugated
Supplier Page Shop

Product images