MAP4K5 Antibody

Name MAP4K5 Antibody
Supplier Novus Biologicals
Catalog NBP1-58850
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MAP4K5(mitogen-activated protein kinase kinase kinase kinase 5) The peptide sequence was selected from the middle region of MAP4K5. Peptide sequence QGKSFKSDEVTQEISDETRVFRLLGSDRVVVLESRPTENPTAHSNLYILA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MAP4K5
Conjugate Unconjugated
Supplier Page Shop

Product images