YTHD1 Antibody
| Name | YTHD1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-52865 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to YTHDF1(YTH domain family, member 1) The peptide sequence was selected from the middle region of YTHDF1. Peptide sequence QQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNA. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | YTHDF1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: YTHD1 Antibody [NBP1-52865] - Sample Tissue: Human Ovary Tumor Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7253_YTHD1-Antibody-Western-Blot-NBP1-52865-img0003.jpg)
![Western Blot: YTHD1 Antibody [NBP1-52865] - Reccomended Titration: 0.2 - 1 ug/ml Positive Control: HepG2 cell lysate YTHDF1 is supported by BioGPS gene expression data to be expressed in HepG2](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7254_YTHD1%2520Antibody-Western%2520Blot-NBP1-52865-img0004.jpg)