| Name | PGS1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-52834 |
| Prices | $299.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Bovine, Dog, Horse, Guinea Pig, Rabbit, Zebrafish |
| Antigen | Synthetic peptides corresponding to PGS1(phosphatidylglycerophosphate synthase 1) The peptide sequence was selected from the C terminal of PGS1. Peptide sequence RVQLQEYWRRGWTFHAKGLWLYLAGSSLPCLTLIGSPNFGYRSVHRDLEA. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | PGS1 |
| Supplier Page | Shop |