PRDM15 Antibody

Name PRDM15 Antibody
Supplier Novus Biologicals
Catalog NBP1-52842
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PRDM15(PR domain containing 15) The peptide sequence was selected from the middle region of PRDM15. Peptide sequence LCGTKVSTRASMSRHMRRKHPEVLAVRIDDLDHLPETTTIDASSIGIVQP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PRDM15
Conjugate Unconjugated
Supplier Page Shop

Product images