CC2D1B Antibody

Name CC2D1B Antibody
Supplier Novus Biologicals
Catalog NBP1-52841
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to CC2D1B(coiled-coil and C2 domain containing 1B) The peptide sequence was selected from the C terminal of CC2D1B. Peptide sequence IVRGMNLPAPPGVTPDDLDAFVRFEFHYPNSDQAQKSKTAVVKNTNSPEF.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene CC2D1B
Supplier Page Shop

Product images