GMPR2 Antibody

Name GMPR2 Antibody
Supplier Novus Biologicals
Catalog NBP1-52837
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to GMPR2(guanosine monophosphate reductase 2) The peptide sequence was selected from the C terminal of GMPR2. Peptide sequence GAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGV.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene GMPR2
Conjugate Unconjugated
Supplier Page Shop

Product images