HNF-4 gamma/NR2A2 Antibody
| Name | HNF-4 gamma/NR2A2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-52810 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to HNF4G(hepatocyte nuclear factor 4, gamma) The peptide sequence was selected from the C terminal of HNF4G (NP_004124). Peptide sequence QDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQAS. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | HNF4G |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: HNF-4 gamma/NR2A2 Antibody [NBP1-52810] - Human Adult Placenta Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6960_HNF-4-gamma-NR2A2-Antibody-Western-Blot-NBP1-52810-img0003.jpg)
![Western Blot: HNF-4 gamma/NR2A2 Antibody [NBP1-52810] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6961_HNF-4-gamma-NR2A2-Antibody-Western-Blot-NBP1-52810-img0002.jpg)