TTC5 Antibody

Name TTC5 Antibody
Supplier Novus Biologicals
Catalog NBP1-53012
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to TTC5(tetratricopeptide repeat domain 5) The peptide sequence was selected from the C terminal of TTC5. Peptide sequence GDSVAIPEPNLRLHRIQHKGKDYSFSSVRVETPLLLVVNGKPQGSSSQAV.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene TTC5
Supplier Page Shop

Product images