RSF1 Antibody

Name RSF1 Antibody
Supplier Novus Biologicals
Catalog NBP1-52999
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to RSF1(remodeling and spacing factor 1) The peptide sequence was selected from the middle region of RSF1. Peptide sequence QDEFVVSDENPDESEEDPPSNDDSDTDFCSRRLRRHPSRPMRQSRRLRRK.
Purity/Format Affinity purified
Description Rabbit Polyclonal
Gene RSF1
Supplier Page Shop

Product images