TRM11 Antibody

Name TRM11 Antibody
Supplier Novus Biologicals
Catalog NBP1-52998
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TRMT11(tRNA methyltransferase 11 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of TRMT11. Peptide sequence IKIHTFNKTLTQEEKIKRIDALEFLPFEGKVNLKKPQHVFSVLEDYGLDP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TRMT11
Conjugate Unconjugated
Supplier Page Shop

Product images