PDE1C Antibody

Name PDE1C Antibody
Supplier Novus Biologicals
Catalog NBP1-52956
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PDE1C(phosphodiesterase 1C, calmodulin-dependent 70kDa) The peptide sequence was selected from the middle region of PDE1C. Peptide sequence IDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PDE1C
Conjugate Unconjugated
Supplier Page Shop

Product images