TRIB2 Antibody

Name TRIB2 Antibody
Supplier Novus Biologicals
Catalog NBP1-52952
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TRIB2(tribbles homolog 2 (Drosophila)) The peptide sequence was selected from the middle region of TRIB2. Peptide sequence YPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TRIB2
Conjugate Unconjugated
Supplier Page Shop

Product images