ASF1b Antibody

Name ASF1b Antibody
Supplier Novus Biologicals
Catalog NBP1-52947
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ASF1B(ASF1 anti-silencing function 1 homolog B (S. cerevisiae)) The peptide sequence was selected from the middle region of ASF1B. Peptide sequence YHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFH.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ASF1B
Conjugate Unconjugated
Supplier Page Shop

Product images