PNMA1 Antibody

Name PNMA1 Antibody
Supplier Novus Biologicals
Catalog NBP1-52935
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PNMA1(paraneoplastic antigen MA1) The peptide sequence was selected from the middle region of PNMA1. Peptide sequence KSNNPAITTAECLKALEQVFGSVESSRDAQIKFLNTYQNPGEKLSAYVIR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PNMA1
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.