SMC2 Antibody

Name SMC2 Antibody
Supplier Novus Biologicals
Catalog NBP1-52932
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SMC2(structural maintenance of chromosomes 2) The peptide sequence was selected from the N terminal of SMC2. Peptide sequence ISNLSQVRASNLQDLVYKNGQAGITKASVSITFDNSDKKQSPLGFEVHDE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RAB33B
Conjugate Unconjugated
Supplier Page Shop

Product images