POLR3F Antibody
| Name | POLR3F Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-52916 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to POLR3F(polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa) The peptide sequence was selected from the middle region of POLR3F. Peptide sequence LNQQCFKFLQSKAETARESKQNPMIQRNSSFASSHEVWKYICELGISKVE. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | POLR3F |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: POLR3F Antibody [NBP1-52916] - Human 293T, Antibody Dilution: 1.0 ug/ml POLR3F is supported by BioGPS gene expression data to be expressed in HEK293T.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6855_POLR3F%2520Antibody-Western%2520Blot-NBP1-52916-img0004.jpg)
![Western Blot: POLR3F Antibody [NBP1-52916] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6856_POLR3F-Antibody-Western-Blot-NBP1-52916-img0003.jpg)