eEF1A1 Antibody
| Name | eEF1A1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-52880 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to EEF1A1(eukaryotic translation elongation factor 1 alpha 1) The peptide sequence was selected from the C terminal of EEF1A1 (NP_001393). Peptide sequence IVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGK. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | EEF1A1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: eEF1A1 Antibody [NBP1-52880] - Antibody Titration: 1 ug/ml Human Hela.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6851_eEF1A1-Antibody-Western-Blot-NBP1-52880-img0003.jpg)
![Western Blot: eEF1A1 Antibody [NBP1-52880] - HepG2 cell lysate, concentration 2.5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6852_eEF1A1-Antibody-Western-Blot-NBP1-52880-img0002.jpg)