MNS1 Antibody

Name MNS1 Antibody
Supplier Novus Biologicals
Catalog NBP1-53041
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MNS1(meiosis-specific nuclear structural 1) The peptide sequence was selected from the middle region of MNS1. Peptide sequence KVQENEEKRLQLQNALTQKLEEMLRQREDLEQVRQELYQEEQAEIYKSKL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MNS1
Conjugate Unconjugated
Supplier Page Shop

Product images