MORC3 Antibody

Name MORC3 Antibody
Supplier Novus Biologicals
Catalog NBP1-53029
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MORC3(MORC family CW-type zinc finger 3) The peptide sequence was selected from the N terminal of MORC3. Peptide sequence KLLAELDAIIGKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDLDEIT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MORC3
Conjugate Unconjugated
Supplier Page Shop

Product images