DECR2 Antibody

Name DECR2 Antibody
Supplier Novus Biologicals
Catalog NBP1-53172
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to DECR2(2,4-dienoyl CoA reductase 2, peroxisomal) The peptide sequence was selected from the N terminal of DECR2. Peptide sequence MAQPPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMR.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene DECR2
Conjugate Unconjugated
Supplier Page Shop

Product images