LSS Antibody
| Name | LSS Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-53166 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to LSS(lanosterol synthase (2,3-oxidosqualene-lanosterol cyclase)) The peptide sequence was selected from the middle region of LSS. Peptide sequence KCPHVTEHIPRERLCDAVAVLLNMRNPDGGFATYETKRGGHLLELLNPSE. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | LSS |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: LSS Antibody [NBP1-53166] - Human Liver cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24888_LSS-Antibody-Western-Blot-NBP1-53166-img0002.jpg)
Western Blot: LSS Antibody [NBP1-53166] - Human Liver cell lysate, concentration 0.2-1 ug/ml.
![Immunohistochemistry: LSS Antibody [NBP1-53166] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: N/A Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24889_LSS-Antibody-Immunohistochemistry-NBP1-53166-img0003.jpg)
Immunohistochemistry: LSS Antibody [NBP1-53166] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: N/A Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec