Cytosolic Sulfotransferase 1C2/SULT1C2 Antibody
| Name | Cytosolic Sulfotransferase 1C2/SULT1C2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-53102 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SULT1C2(sulfotransferase family, cytosolic, 1C, member 2) The peptide sequence was selected from the C terminal of SULT1C2 (NP_001047). Peptide sequence LDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SULT1C2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Cytosolic Sulfotransferase 1C2/SULT1C2 Antibody [NBP1-53102] - Hela cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/14730_Cytosolic-Sulfotransferase-1C2-SULT1C2-Antibody-Western-Blot-NBP1-53102-img0003.jpg)
Western Blot: Cytosolic Sulfotransferase 1C2/SULT1C2 Antibody [NBP1-53102] - Hela cell lysate, concentration 0.2-1 ug/ml.