Myozenin 1 Antibody

Name Myozenin 1 Antibody
Supplier Novus Biologicals
Catalog NBP1-53083
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MYOZ1(myozenin 1) The peptide sequence was selected from the middle region of MYOZ1 (NP_067068). Peptide sequence TVFKTYISPWERAMGVDPQQKMELGIDLLAYGAKAELPKYKSFNRTAMPY.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MYOZ1
Conjugate Unconjugated
Supplier Page Shop

Product images